MNGVRDPPLFIKDIKPGLKNLNVVFIVLEIGRVTKTKDGHEVRSCKVADKTGSITISVWDEIGGLIQPGDIIRLTRGYASMWKGCLTLYTGRGGELQKIGEFCMVYSELPNFSEPNPDYRGQQNKGAHNEQKNNSMNNSNNVGTGTFGPMGNGVQTGAEARGCQFSYAGRSNGRGPINPQLPGTANNQTVMTTISNGRDPRRAFKR Sensor of ssDNA subunit B2 Oligonucleotide/oligosaccharide-binding fold-containing protein 2A SSB2 SOSS complex subunit B2 OBFC2A 206 Component of the SOSS complex, a multiprotein complex that functions downstream of the MRN complex to promote DNA repair and G2/M checkpoint. In the SOSS complex, acts as a sensor of single-stranded DNA that binds to single-stranded DNA, in particular to polypyrimidines. The SOSS complex associates with DNA lesions and influences diverse endpoints in the cellular DNA damage response including cell-cycle checkpoint activation, recombinational repair and maintenance of genomic stability. Required for efficient homologous recombination-dependent repair of double-strand breaks (DSBs) and ATM-dependent signaling pathways (By similarity). SOSB2_BOVIN Single-stranded DNA-binding protein 2 Sensor of single-strand DNA complex subunit B2